Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Flagellar biosynthetic protein fliR (fliR)

This Recombinant Bacillus subtilis Flagellar biosynthetic protein fliR (fliR) spans the amino acid sequence from region 1-259.

Product Specifications

Product Name Alternative

Flagellar biosynthetic protein fliR

UniProt

P35537

Expression Region

1-259

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNSIIDLFPAFLLVFIRISAFFVTIPLFGHRNVPAVHRIGFAFFLAVICFSTIDKPPSLE IDEHYMLLAFKEALVGLCLGLIAYMMIAAVQIAGSFIDFQMGFSIANVIDPQTGAQSPLI GQFIYTMALLFMLSVNAHHLLLDGIYYSFQYISVDQAFPNFGDEKFAYFIAKSFNAMFII AFQMSAPVVASLFLVDLALGIVARTVPQLNVFVVGLPLKIAVSFIMLIVCMSVIFVVVRN VFSLTIETMRNLLALVGVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRPL46 Overexpression Lysate (Native) - (Dry Ice)
NBL1-13273 0.1 mg

MRPL46 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
SERBP1 Human shRNA Plasmid Kit (Locus ID 26135)
TG309546 1 Kit

SERBP1 Human shRNA Plasmid Kit (Locus ID 26135)

Sign In for Pricing
View Details
5X Tris-Glycine-SDS Gel Running Buffer
ML041-2X500ML 1 unit

5X Tris-Glycine-SDS Gel Running Buffer

Sign In for Pricing
View Details
ERLIN1 Human Pre-designed siRNA Set A
HY-RS04501 1 Set

ERLIN1 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
TSPAN3 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-9412R-BF350 100 µL

TSPAN3 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
Mouse Monoclonal CD163L1 Antibody (CD163L1/7974)
NBP3-23717-20ug 20 µg

Mouse Monoclonal CD163L1 Antibody (CD163L1/7974)

Sign In for Pricing
View Details