Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Flagellar biosynthetic protein fliR (fliR)

This Recombinant Bacillus subtilis Flagellar biosynthetic protein fliR (fliR) spans the amino acid sequence from region 1-259.

Product Specifications

Product Name Alternative

Flagellar biosynthetic protein fliR

UniProt

P35537

Expression Region

1-259

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNSIIDLFPAFLLVFIRISAFFVTIPLFGHRNVPAVHRIGFAFFLAVICFSTIDKPPSLE IDEHYMLLAFKEALVGLCLGLIAYMMIAAVQIAGSFIDFQMGFSIANVIDPQTGAQSPLI GQFIYTMALLFMLSVNAHHLLLDGIYYSFQYISVDQAFPNFGDEKFAYFIAKSFNAMFII AFQMSAPVVASLFLVDLALGIVARTVPQLNVFVVGLPLKIAVSFIMLIVCMSVIFVVVRN VFSLTIETMRNLLALVGVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Ileum
CB538021 1 Block

Frozen Tissue Blocks, Ileum

Sign In for Pricing
View Details
Cd99 ORF Vector (Mouse) (pORF)
15584014 1.0 µg DNA

Cd99 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Oas1a Protein Vector (Rat) (pPB-N-His)
PV286599 500 ng

Oas1a Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
AKAP4 discontinued
305333 100 µL

AKAP4 discontinued

Sign In for Pricing
View Details
Fastk, NT (Fastk, Fas-activated serine/threonine kinase) (FITC)
MBS6298090-01 0.2 mL

Fastk, NT (Fastk, Fas-activated serine/threonine kinase) (FITC)

Sign In for Pricing
View Details
Fastk, NT (Fastk, Fas-activated serine/threonine kinase) (FITC)
MBS6298090-02 5x 0.2 mL

Fastk, NT (Fastk, Fas-activated serine/threonine kinase) (FITC)

Sign In for Pricing
View Details