Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shewanella amazonensis Cobalamin synthase (cobS)

This Recombinant Shewanella amazonensis Cobalamin synthase (cobS) spans the amino acid sequence from region 1-260.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

A1S3L4

Expression Region

1-260

Origin

Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTFKRELELFLLALTFFTRIPVPVKLDYSGEGLNRASRYFGLVGTLVGLIAALVFYLTQ FIFPASVAVVLAMIATVLLTGGFHEDGLADTADGFGGAFERERKLEIMKDSRVGSYGSLA LMLALLLKFQLLSELALYSVSSVAGGLVLGHTLSRAFAASIIFNHTYVREDAESKAKPLA QSMHWDEVLFLVLSAGVICLLLTGVGATLVILVTLFVARSLLARWQSRHIGGYTGDTLGA CQQILELVVYLVLLLLWSQS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Fibroblast Growth Factor 1, Acidic (FGF1) ELISA Kit
EKU04120 96 Tests

Bovine Fibroblast Growth Factor 1, Acidic (FGF1) ELISA Kit

Sign In for Pricing
View Details
4921536K21Rik CRISPR Activation Plasmid (m)
sc-426555-ACT 20 µg

4921536K21Rik CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
Mouse Anti Human TTR Monoclonal Clone 2A4 200UL
IMSAHUTTR2A4C200UL 200 µL

Mouse Anti Human TTR Monoclonal Clone 2A4 200UL

Sign In for Pricing
View Details
Thymidylate Synthase (5-FU Resistance Marker) (TYMS/1884), 0.2mg/mL
BNUB1884-500 1x 500 µL

Thymidylate Synthase (5-FU Resistance Marker) (TYMS/1884), 0.2mg/mL

Sign In for Pricing
View Details
BCL7B (B Cell CLL/Lymphoma 7 Protein Family Member B) (Biotin)
MBS6408414-01 0.1 mL

BCL7B (B Cell CLL/Lymphoma 7 Protein Family Member B) (Biotin)

Sign In for Pricing
View Details
BCL7B (B Cell CLL/Lymphoma 7 Protein Family Member B) (Biotin)
MBS6408414-02 5x 0.1 mL

BCL7B (B Cell CLL/Lymphoma 7 Protein Family Member B) (Biotin)

Sign In for Pricing
View Details