Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shewanella amazonensis Cobalamin synthase (cobS)

This Recombinant Shewanella amazonensis Cobalamin synthase (cobS) spans the amino acid sequence from region 1-260.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

A1S3L4

Expression Region

1-260

Origin

Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTFKRELELFLLALTFFTRIPVPVKLDYSGEGLNRASRYFGLVGTLVGLIAALVFYLTQ FIFPASVAVVLAMIATVLLTGGFHEDGLADTADGFGGAFERERKLEIMKDSRVGSYGSLA LMLALLLKFQLLSELALYSVSSVAGGLVLGHTLSRAFAASIIFNHTYVREDAESKAKPLA QSMHWDEVLFLVLSAGVICLLLTGVGATLVILVTLFVARSLLARWQSRHIGGYTGDTLGA CQQILELVVYLVLLLLWSQS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Macrophage mannose receptor 1
AP85652-01 50 µg

Macrophage mannose receptor 1

Sign In for Pricing
View Details
Macrophage mannose receptor 1
AP85652-02 100 µg

Macrophage mannose receptor 1

Sign In for Pricing
View Details
Macrophage mannose receptor 1
AP85652-03 1 mg

Macrophage mannose receptor 1

Sign In for Pricing
View Details
Research Grade Anti-Human TNFa/TNF-alpha (DLX105)
DHB94422 100 μg

Research Grade Anti-Human TNFa/TNF-alpha (DLX105)

Sign In for Pricing
View Details
Recombinant Mouse IL-22BP His-tag Protein CF
9597-BP-050 50 µg

Recombinant Mouse IL-22BP His-tag Protein CF

Sign In for Pricing
View Details
SPINK5 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
45335061 1.0 µg DNA

SPINK5 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details