Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhizobium etli Cobalamin synthase (cobS)

This Recombinant Rhizobium etli Cobalamin synthase (cobS) spans the amino acid sequence from region 1-260.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

B3PQS4

Expression Region

1-260

Origin

Rhizobium etli (strain CIAT 652)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKIKDYAVDTARAVAFLSRLPMPPALFNGYDGRLGRLVRAFPFAGLLIGFVPAFALLLLL GLRADPLVAALVALAVQALVTGALHEDGLADTADGIGGGKSREQSLIIMKDSRIGTYGAI ALILSFAIRAAALAAIVRHSSPLAAVLAIPAVAALSRGAITWHWQRLPPAKADGVAASTG QPDEAAMHFALVAAGLLAALLIWPAFGLWPLVASLLAAGAAGFVCTVFIRRRLAGHTGDT LGATQQICEIATLCALATAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD27 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5G2B3]
TA812511AM 100 µL

CD27 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5G2B3]

Sign In for Pricing
View Details
Rabbit Polyclonal Antibody
TA392632 100 µL

Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ARHGAP8 (NM_181335) Human Recombinant Protein
TP318707M 100 µg

ARHGAP8 (NM_181335) Human Recombinant Protein

Sign In for Pricing
View Details
Fencamine
TRC-F247300-5MG 5 mg

Fencamine

Sign In for Pricing
View Details
Human SULT6B1 activation kit by CRISPRa
GA118213 1 Kit

Human SULT6B1 activation kit by CRISPRa

Sign In for Pricing
View Details
ELAVL1 Human Gene Knockout Kit (CRISPR)
KN201562BN 1 Kit

ELAVL1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details