Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhizobium etli Cobalamin synthase (cobS)

This Recombinant Rhizobium etli Cobalamin synthase (cobS) spans the amino acid sequence from region 1-260.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

B3PQS4

Expression Region

1-260

Origin

Rhizobium etli (strain CIAT 652)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKIKDYAVDTARAVAFLSRLPMPPALFNGYDGRLGRLVRAFPFAGLLIGFVPAFALLLLL GLRADPLVAALVALAVQALVTGALHEDGLADTADGIGGGKSREQSLIIMKDSRIGTYGAI ALILSFAIRAAALAAIVRHSSPLAAVLAIPAVAALSRGAITWHWQRLPPAKADGVAASTG QPDEAAMHFALVAAGLLAALLIWPAFGLWPLVASLLAAGAAGFVCTVFIRRRLAGHTGDT LGATQQICEIATLCALATAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VPS26 (VPS26A) Human qPCR Primer Pair (NM_004896)
HP228271 200 Reactions

VPS26 (VPS26A) Human qPCR Primer Pair (NM_004896)

Sign In for Pricing
View Details
3,5-Di-tert-butyl-4-hydroxyphenylpropionic Acid
TRC-D417555-5G 5 g

3,5-Di-tert-butyl-4-hydroxyphenylpropionic Acid

Sign In for Pricing
View Details
Mesothelin (Mesothelial Marker) (MSLN/2131), Biotin conjugate, 0.1mg/mL
BNCB2131-500 1x 500 µL

Mesothelin (Mesothelial Marker) (MSLN/2131), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (EPO104), 0.2mg/mL
BNUB0104-500 1x 500 µL

Eosinophil Peroxidase (EPO104), 0.2mg/mL

Sign In for Pricing
View Details
FITC Conjugated Anti-Mouse CD4 Recombinant Antibody [PSH04-99] - Rabbit IgG (Chimeric)
HA720202F 100 µL

FITC Conjugated Anti-Mouse CD4 Recombinant Antibody [PSH04-99] - Rabbit IgG (Chimeric)

Sign In for Pricing
View Details
ATRIP Rabbit Polyclonal Antibody
AP20204PU-N 100 µg

ATRIP Rabbit Polyclonal Antibody

Sign In for Pricing
View Details