Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhizobium etli Cobalamin synthase (cobS)

This Recombinant Rhizobium etli Cobalamin synthase (cobS) spans the amino acid sequence from region 1-260.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q2K7G5

Expression Region

1-260

Origin

Rhizobium etli (strain CFN 42 / ATCC 51251)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKIKDYAVDTARAVAFLSRLPMPPALFNGYDGRLNRLVRAFPFAGLLIGFVPAVTLLLLL SLRTDPLVAALVALSVQALVTGALHEDGLADTADGIGGGSSREQSLIIMKDSRIGTYGAI ALILSFAIRAAALAAIIRHSSPLAAALAIPAVAALSRGAIAWHWQRLPPAKPDGVAASNG QPNEAAMHFALVSAGLLAALLIWPPFGLRPLVAGLLVAGVAGFAFTVFIRRKLAGHTGDT LGATQQICEIATLCALATAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant human CD46 protein
ATGP2036-020 20 µg

Recombinant human CD46 protein

Sign In for Pricing
View Details
EFGM Polyclonal Antibody
E11-200696 100 µg -100 µL

EFGM Polyclonal Antibody

Sign In for Pricing
View Details
KIAA0090 (EMC1) (NM_015047) Human Tagged Lenti ORF Clone
RC207231L2 10 µg

KIAA0090 (EMC1) (NM_015047) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
RDX Recombinant Protein (Mouse)
RP167486 100 µg

RDX Recombinant Protein (Mouse)

Sign In for Pricing
View Details
PCMV-PTPRF (human) -tdTomato-Neo
BZ61877 1 Vial

PCMV-PTPRF (human) -tdTomato-Neo

Sign In for Pricing
View Details
Rabbit Monoclonal EphB4 Antibody (201) [DyLight 405]
NBP2-89354V 0.1 mL

Rabbit Monoclonal EphB4 Antibody (201) [DyLight 405]

Sign In for Pricing
View Details