Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus tropicalis Fat storage-inducing transmembrane protein 2 (fitm2)

This Recombinant Xenopus tropicalis Fat storage-inducing transmembrane protein 2 (fitm2) spans the amino acid sequence from region 1-260.

Product Specifications

Product Name Alternative

Fat storage-inducing transmembrane protein 2, Fat-inducing protein 2

UniProt

A0JP80

Expression Region

1-260

Origin

Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MERLENCAQMFQRRFLNESFRRHCPVLLACIVLGGSLLKELCPLPDSYWNNKRNVLNVYF VKFSWGWTLWLLLPFIALTNYKLTRSTTKVLRRLSSLLVSTLIWYLCTNLFLYIENITGS CYESEAMSDPKEHQDRRECRLHSGYWHGFDISGHCFLLSYCILLILEETSIISNIRFERH WHRMAINAQFAALSILVIIWVWMFLCTAVYFHNIFQKVIGTAFGILAWYITYRWWYLQPI SPGLPPASASRSGKEPIYRN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 5AC (MUC5AC) (45M1), CF405S conjugate, 0.1mg/mL
BNC040031-500 1x 500 µL

Mucin 5AC (MUC5AC) (45M1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (VCAM1/843), CF594 conjugate, 0.1mg/mL
BNC940843-100 1x 100 µL

CD106 / VCAM1 (VCAM1/843), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain (B-Cell Marker) (rKLC264), CF488A conjugate, 0.1mg/mL
BNC882171-500 1x 500 µL

Human Kappa Light Chain (B-Cell Marker) (rKLC264), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HER-2 / CD340 (HRB2/718), CF405S conjugate, 0.1mg/mL
BNC040718-100 1x 100 µL

HER-2 / CD340 (HRB2/718), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (BCL6/1951R), CF640R conjugate, 0.1mg/mL
BNC401951-100 1x 100 µL

Bcl-6 (Follicular Lymphoma Marker) (BCL6/1951R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF568 conjugate, 0.1mg/mL
BNC680322-500 1x 500 µL

CD3e (RIV9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details