Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycoplasma genitalium Uncharacterized protein MG452 (MG452)

This Recombinant Mycoplasma genitalium Uncharacterized protein MG452 (MG452) spans the amino acid sequence from region 1-261.

Product Specifications

Product Name Alternative

Uncharacterized protein MG452

UniProt

P47690

Expression Region

1-261

Origin

Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLIIFKDLNLVKTNNCQIIGWWKQLSLPQKTFLSFIPLFLVTSAFVLTGIVESLLTFGTI IEQIDKFTDQTNVMLLIYAVIYTFNPKSWLLKNQQFFLSALAYILFTFIGYNLILSIAGI AYKSTNPYKLTSSIFLHVIAPIAFFIASFIKIKHEKDVNINMFFKSLLLFMIYPLIYGLY LVTIPYVRHYLFNGRPSTYTIYGSITNTKNNPFAWLVVFAVLFIYFPLSYLAIYLLQLKL IKKAIQPQFNLPFTLNKWKQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Gch1 activation kit by CRISPRa
GA201568 1 Kit

Mouse Gch1 activation kit by CRISPRa

Sign In for Pricing
View Details
Colorimeter BMET-810
BMET-810 1 Unit

Colorimeter BMET-810

Sign In for Pricing
View Details
FGFR1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6F8]
TA802989AM 100 µL

FGFR1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6F8]

Sign In for Pricing
View Details
Levosimendan
TRC-L378000-250MG 250 mg

Levosimendan

Sign In for Pricing
View Details
Diclofensine-d3 Hydrochloride
TRC-D436582-1MG 1 mg

Diclofensine-d3 Hydrochloride

Sign In for Pricing
View Details
Thiocolchicoside S-Oxide (Mixture of Diastereomers)
TRC-T344645-50MG 50 mg

Thiocolchicoside S-Oxide (Mixture of Diastereomers)

Sign In for Pricing
View Details