Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mammuthus primigenius Cytochrome c oxidase subunit 3 (MT-CO3)

This Recombinant Mammuthus primigenius Cytochrome c oxidase subunit 3 (MT-CO3) spans the amino acid sequence from region 1-261.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 3, Cytochrome c oxidase polypeptide III

UniProt

Q38PR6

Expression Region

1-261

Origin

Mammuthus primigenius (Siberian woolly mammoth)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTHQTHAYHMVDPSPWPLTGALSALLMTSGLTMWFHYHSVVLLFLGLMTNTLTMFQWWRD VVREGTFQGHHTPVVQEGLRYGMILFITSEVLFFTGFFWAFYHSSLAPTPELGSYWPPVG VYPLNPLEVPLLNTSVLLASGVTITWAHHSLMEGNRKNMLQALLITILLGVYFTLLQMFE YYEASFTISDGIYGSTFFVTTGFHGLHVIIGSTFLLTCFIRQLKFHFTSNHHFGFEAAAW YWHFVDVVWLFLYLSIYWWGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H1 (AE-4), CF488A conjugate, 0.1mg/mL
BNC880096-500 1x 500 µL

Histone H1 (AE-4), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF555 conjugate, 0.1mg/mL
BNC550017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF640R conjugate, 0.1mg/mL
BNC400193-100 1x 100 µL

CD86 (BU63), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF594 conjugate, 0.1mg/mL
BNC940193-500 1x 500 µL

CD86 (BU63), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF555 conjugate, 0.1mg/mL
BNC550146-500 1x 500 µL

CD10 (CB-CALLA), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-2 (124), CF740 conjugate, 0.1mg/mL
BNC740530-500 1x 500 µL

Bcl-2 (124), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details