Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lactococcus lactis subsp. lactis UPF0177 protein yvdC (yvdC)

This Recombinant Lactococcus lactis subsp. lactis UPF0177 protein yvdC (yvdC) spans the amino acid sequence from region 1-261.

Product Specifications

Product Name Alternative

UPF0177 protein yvdC

UniProt

Q9CE03

Expression Region

1-261

Origin

Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFNIEKLQSLAKYRWVIVIILALLFSALSVSIFHLPFLMTALVLSIVGLIFAYHKSVWLV LFILSNLPMLATTIFAYQHHFTTLDTVIFFIIFLLTIISSYLIARKADIIPKISWKYFPP LKIIIGFALLFLVSILTGIFAQIINQSPTTSNQDSLNELQKVIPIAVFATQTLAAGFLEE LVYRVGIFEVIFKNQKYFAFLTALLLFAYMHGPTDLYSWLTYGLMSLVLTSLYAKYRNFY LNMSVHLLWNLFGLVIALVLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human LECT2 shRNA (UAS) - Lentiviral human LECT2 shRNA (UAS, GFP) (100)
GTR15331068 1 Vial

Lentiviral human LECT2 shRNA (UAS) - Lentiviral human LECT2 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Olr1291 AAV siRNA Pooled Vector
33812166 1.0 µg

Olr1291 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
SCGB1A1 (Uteroglobin, Clara Cell Phospholipid-binding Protein, CCPBP, Clara Cells 10kD Secretory Protein, CC10, Secretoglobin Family 1A Member 1, Urinary Protein 1, UP-1, UP1, Urine Protein 1, CC10, CCSP, UGB) (MaxLight 750)
MBS6393330-01 0.1 mL

SCGB1A1 (Uteroglobin, Clara Cell Phospholipid-binding Protein, CCPBP, Clara Cells 10kD Secretory Protein, CC10, Secretoglobin Family 1A Member 1, Urinary Protein 1, UP-1, UP1, Urine Protein 1, CC10, CCSP, UGB) (MaxLight 750)

Sign In for Pricing
View Details
SCGB1A1 (Uteroglobin, Clara Cell Phospholipid-binding Protein, CCPBP, Clara Cells 10kD Secretory Protein, CC10, Secretoglobin Family 1A Member 1, Urinary Protein 1, UP-1, UP1, Urine Protein 1, CC10, CCSP, UGB) (MaxLight 750)
MBS6393330-02 5x 0.1 mL

SCGB1A1 (Uteroglobin, Clara Cell Phospholipid-binding Protein, CCPBP, Clara Cells 10kD Secretory Protein, CC10, Secretoglobin Family 1A Member 1, Urinary Protein 1, UP-1, UP1, Urine Protein 1, CC10, CCSP, UGB) (MaxLight 750)

Sign In for Pricing
View Details
FBXW12 sgRNA CRISPR Lentivector (Human) (Target 1)
K0768302 1.0 µg DNA

FBXW12 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
ARMCX3 Polyclonal Antibody
MBS2575670-01 0.06 mL

ARMCX3 Polyclonal Antibody

Sign In for Pricing
View Details