Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lactococcus lactis subsp. lactis UPF0177 protein yvdC (yvdC)

This Recombinant Lactococcus lactis subsp. lactis UPF0177 protein yvdC (yvdC) spans the amino acid sequence from region 1-261.

Product Specifications

Product Name Alternative

UPF0177 protein yvdC

UniProt

Q9CE03

Expression Region

1-261

Origin

Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFNIEKLQSLAKYRWVIVIILALLFSALSVSIFHLPFLMTALVLSIVGLIFAYHKSVWLV LFILSNLPMLATTIFAYQHHFTTLDTVIFFIIFLLTIISSYLIARKADIIPKISWKYFPP LKIIIGFALLFLVSILTGIFAQIINQSPTTSNQDSLNELQKVIPIAVFATQTLAAGFLEE LVYRVGIFEVIFKNQKYFAFLTALLLFAYMHGPTDLYSWLTYGLMSLVLTSLYAKYRNFY LNMSVHLLWNLFGLVIALVLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PTEN-Like Phosphatase (PTPMT1) AssayLite™ Antibody (PerCP Conjugate)
36157-05171 5x 30 µg

Human PTEN-Like Phosphatase (PTPMT1) AssayLite™ Antibody (PerCP Conjugate)

Sign In for Pricing
View Details
RPL7AP38 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV775338 1.0 µg DNA

RPL7AP38 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Tenofovir - Bio-X TM
BT164455 10 mg

Tenofovir - Bio-X TM

Sign In for Pricing
View Details
Fam18b2 sgRNA CRISPR Lentivector (Rat) (Target 2)
K7517203 1.0 µg DNA

Fam18b2 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
BPIL3 Polyclonal Antibody, RBITC Conjugated
bs-8425R-RBITC 100 µL

BPIL3 Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details
Mouse Aryl Hydrocarbon Receptor Nuclear Translocator (ARNT) ELISA Kit
orb780355-01 48 Tests

Mouse Aryl Hydrocarbon Receptor Nuclear Translocator (ARNT) ELISA Kit

Sign In for Pricing
View Details