Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Donkey Cytochrome c oxidase subunit 3 (MT-CO3)

This Recombinant Donkey Cytochrome c oxidase subunit 3 (MT-CO3) spans the amino acid sequence from region 1-261.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 3, Cytochrome c oxidase polypeptide III

UniProt

P92481

Expression Region

1-261

Origin

Equus asinus (Donkey)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTHQTHAYHMVNPSPWPLTGALSALLMTSGLAMWFHFNSTLLLALGLLTNILTMYQWWRD IIRESTFQGHHTSIVQKGLRYGMILFIISEVFFFSGFFWAFYHSSLAPTPELGGCWPPTG IHPLNPLEVPLLNTSVLLASGVSITWAHHSLMEGNRKNMLQGLFITISLGVYFTLLQASE YYEASFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFLRQLKFHFTSSHHFGFEAAAW YWHFVDVVWLFLYVSIYWWGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (VU-1D9), CF568 conjugate, 0.1mg/mL
BNC680017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF405S conjugate, 0.1mg/mL
BNC040871-500 1x 500 µL

CD71 (66IG10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF568 conjugate, 0.1mg/mL
BNC680978-500 1x 500 µL

CD7 (T3-3A1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF594 conjugate, 0.1mg/mL
BNC940333-500 1x 500 µL

CD8 (RIV11), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF647 conjugate, 0.1mg/mL
BNC470026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2957), CF405S conjugate, 0.1mg/mL
BNC042957-100 1x 100 µL

Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2957), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details