Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Aquaporin-8 (Aqp8)

This Recombinant Mouse Aquaporin-8 (Aqp8) spans the amino acid sequence from region 1-261.

Product Specifications

Product Name Alternative

Aquaporin-8, AQP-8

UniProt

P56404

Expression Region

1-261

Origin

Mus musculus (Mouse)

Field of Research

Kidney & Urological Research; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGEQTPMCSMDLPEVKVKTSMAGRCRVFWYEQYVQPCIVELVGSALFIFIGCLSVIENS PNTGLLQPALAHGLALGLIIATLGNISGGHFNPAVSLAVTVIGGLKTMLLIPYWISQLFG GLIGAALAKVVSPEERFWNASGAAFAIVQEQEQVAEALGIEIILTMLLVLAVCMGAVNEK TMGPLAPFSIGFSVIVDILAGGSISGACMNPARAFGPAVMAGYWDFHWIYWLGPLLAGLF VGLLIRLLIGDEKTRLILKSR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAG-72 / CA72.4 (B72.3), CF405S conjugate, 0.1mg/mL
BNC040276-500 1x 500 µL

TAG-72 / CA72.4 (B72.3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF640R conjugate, 0.1mg/mL
BNC400460-500 1x 500 µL

CD44 Standard (156-3C11), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF647 conjugate, 0.1mg/mL
BNC470270-500 1x 500 µL

Fibronectin (HFN7.1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF594 conjugate, 0.1mg/mL
BNC940669-100 1x 100 µL

P27 / KIP1 (SX53G8), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF488A conjugate, 0.1mg/mL
BNC880333-100 1x 100 µL

CD8 (RIV11), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, multi (C11), CF405S conjugate, 0.1mg/mL
BNC040393-500 1x 500 µL

Cytokeratin, multi (C11), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details