Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sheep Cytochrome c oxidase subunit 3 (MT-CO3)

This Recombinant Sheep Cytochrome c oxidase subunit 3 (MT-CO3) spans the amino acid sequence from region 1-261.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 3, Cytochrome c oxidase polypeptide III

UniProt

O21619

Expression Region

1-261

Origin

Ovis aries (Sheep)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTHQTHAYHMVNPSPWPLTGALSALLMTSGLIMWFHFNSTALLTLGLTTNMLTMYQWWRD VIRESTFQGHHTPAVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTG IHPLNPLEVPLLNTSVLLASGVSITWAHHSLMEGNRYHMLQALFITIALGVYFTLLQASE YYEAPFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSSHHFGFEAAAW YWHFVDVVWLFLYMSIYWWGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC18 / Mucin 18 / CD146 (OJ79c), CF405S conjugate, 0.1mg/mL
BNC040676-100 1x 100 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF405S conjugate, 0.1mg/mL
BNC040449-500 1x 500 µL

CD104 (UM-A9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF405S conjugate, 0.1mg/mL
BNC040965-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF405S conjugate, 0.1mg/mL
BNC040669-100 1x 100 µL

P27 / KIP1 (SX53G8), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 7 (K72.7), CF594 conjugate, 0.1mg/mL
BNC940757-500 1x 500 µL

Cytokeratin 7 (K72.7), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EGFR (GFR1195), CF740 conjugate, 0.1mg/mL
BNC741195-100 1x 100 µL

EGFR (GFR1195), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details