Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant NADH-ubiquinone oxidoreductase chain 1 (ND1)

This Recombinant NADH-ubiquinone oxidoreductase chain 1 (ND1) spans the amino acid sequence from region 1-261.

Product Specifications

Product Name Alternative

NADH-ubiquinone oxidoreductase chain 1, EC= 1.6.5.3, NADH dehydrogenase subunit 1

UniProt

P05513

Expression Region

1-261

Origin

Paramecium tetraurelia

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLIYSIVLMLVVTLIIASITLLERKLLSLVQRRVGPNFVGYKGRLQYLADALKLFLKGVA IPSGANSFFFVAMPSLAGAVCYTFWMNSIWGPSLSMFDVEYNIVYASLLSILFGLCVMLT GYFSKNKYSVMAGLRAAILMLNLEIFLGIVFLNVCFLVESFSFAAFAVYQEIFWLIFLFF FLLSNILLVFLLEVNRTPFDLAEAESELVTGYTTEYGGFYFALFYLGEYFHLFFFSCLIS VVFFGSWELLKPFLFLHNYTV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eosinophil Peroxidase (AHE-1), CF488A conjugate, 0.1mg/mL
CD104 (UM-A9), CF405S conjugate, 0.1mg/mL
BNC040449-500 1x 500 µL

CD104 (UM-A9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF647 conjugate, 0.1mg/mL
BNC470745-100 1x 100 µL

CD45 / LCA (2B11 + PD7/26), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF594 conjugate, 0.1mg/mL
BNC940437-100 1x 100 µL

CD47 (B6H12.2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HER-2 / CD340 (HRB2/451), CF640R conjugate, 0.1mg/mL
BNC400451-100 1x 100 µL

HER-2 / CD340 (HRB2/451), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details