Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant NADH-ubiquinone oxidoreductase chain 1 (ND1)

This Recombinant NADH-ubiquinone oxidoreductase chain 1 (ND1) spans the amino acid sequence from region 1-261.

Product Specifications

Product Name Alternative

NADH-ubiquinone oxidoreductase chain 1, EC= 1.6.5.3, NADH dehydrogenase subunit 1

UniProt

P05513

Expression Region

1-261

Origin

Paramecium tetraurelia

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLIYSIVLMLVVTLIIASITLLERKLLSLVQRRVGPNFVGYKGRLQYLADALKLFLKGVA IPSGANSFFFVAMPSLAGAVCYTFWMNSIWGPSLSMFDVEYNIVYASLLSILFGLCVMLT GYFSKNKYSVMAGLRAAILMLNLEIFLGIVFLNVCFLVESFSFAAFAVYQEIFWLIFLFF FLLSNILLVFLLEVNRTPFDLAEAESELVTGYTTEYGGFYFALFYLGEYFHLFFFSCLIS VVFFGSWELLKPFLFLHNYTV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin, LMW (AE-1), CF594 conjugate, 0.1mg/mL
BNC940253-100 1x 100 µL

Cytokeratin, LMW (AE-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF405S conjugate, 0.1mg/mL
BNC040305-500 1x 500 µL

CD95 (B-R18), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF647 conjugate, 0.1mg/mL
BNC470333-500 1x 500 µL

CD8 (RIV11), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF405S conjugate, 0.1mg/mL
BNC040449-500 1x 500 µL

CD104 (UM-A9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF568 conjugate, 0.1mg/mL
BNC680342-100 1x 100 µL

CD43 (84-3C1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF647 conjugate, 0.1mg/mL
BNC470146-500 1x 500 µL

CD10 (CB-CALLA), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details