Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nodulation protein J (nodJ)

This Recombinant Nodulation protein J (nodJ) spans the amino acid sequence from region 1-262.

Product Specifications

Product Name Alternative

Nodulation protein J

UniProt

P50333

Expression Region

1-262

Origin

Rhizobium galegae

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGRVSTEALPSGLLNWVAVWRRNFLAWKKVAPASLLGNLADPMIYIFGLGSGLGVMLGNV GGVSYSAFLAAGMVATSAMTASTFETIYATFARMRDHRTWEAMLYTKLTLGDIVLGEMAW AATKASLAGTAIGIVTATLAYSEWDSLIYVFPVIALTGLAFASLSMVVAALAPSYDYLVF YQSLVITPMLVLSGSVFPVEQLSPMLQRITHLLPLAHSIDLIRPAMLGHPVPDITLHLGA LCLYIVLPFFVSIALLRRRLTQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant HIV gp 120 and gp 41 (aa 485-631) Protein
VAng-0525Lsx-inquire Inquire

Recombinant HIV gp 120 and gp 41 (aa 485-631) Protein

Sign In for Pricing
View Details
Recombinant Conus californicus Conotoxin Cl6.6b
MBS1023387-01 0.05 mg (E-Coli)

Recombinant Conus californicus Conotoxin Cl6.6b

Sign In for Pricing
View Details
Recombinant Conus californicus Conotoxin Cl6.6b
MBS1023387-02 0.2 mg (E-Coli)

Recombinant Conus californicus Conotoxin Cl6.6b

Sign In for Pricing
View Details
Recombinant Conus californicus Conotoxin Cl6.6b
MBS1023387-03 0.05 mg (Yeast)

Recombinant Conus californicus Conotoxin Cl6.6b

Sign In for Pricing
View Details
Recombinant Conus californicus Conotoxin Cl6.6b
MBS1023387-04 0.5 mg (E-Coli)

Recombinant Conus californicus Conotoxin Cl6.6b

Sign In for Pricing
View Details
Recombinant Conus californicus Conotoxin Cl6.6b
MBS1023387-05 0.05 mg (Baculovirus)

Recombinant Conus californicus Conotoxin Cl6.6b

Sign In for Pricing
View Details