Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nodulation protein J (nodJ)

This Recombinant Nodulation protein J (nodJ) spans the amino acid sequence from region 1-262.

Product Specifications

Product Name Alternative

Nodulation protein J

UniProt

P50333

Expression Region

1-262

Origin

Rhizobium galegae

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGRVSTEALPSGLLNWVAVWRRNFLAWKKVAPASLLGNLADPMIYIFGLGSGLGVMLGNV GGVSYSAFLAAGMVATSAMTASTFETIYATFARMRDHRTWEAMLYTKLTLGDIVLGEMAW AATKASLAGTAIGIVTATLAYSEWDSLIYVFPVIALTGLAFASLSMVVAALAPSYDYLVF YQSLVITPMLVLSGSVFPVEQLSPMLQRITHLLPLAHSIDLIRPAMLGHPVPDITLHLGA LCLYIVLPFFVSIALLRRRLTQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIR (Pirin, Probable Quercetin 2,3-dioxygenase PIR, Probable Quercetinase) (MaxLight 405)
MBS6191834-01 0.1 mL

PIR (Pirin, Probable Quercetin 2,3-dioxygenase PIR, Probable Quercetinase) (MaxLight 405)

Sign In for Pricing
View Details
PIR (Pirin, Probable Quercetin 2,3-dioxygenase PIR, Probable Quercetinase) (MaxLight 405)
MBS6191834-02 5x 0.1 mL

PIR (Pirin, Probable Quercetin 2,3-dioxygenase PIR, Probable Quercetinase) (MaxLight 405)

Sign In for Pricing
View Details
COL2A1 ELISA Kit (Rat) (OKCD07026)
OKCD07026 96 Well

COL2A1 ELISA Kit (Rat) (OKCD07026)

Sign In for Pricing
View Details
Rat Prostatic Acid Phosphatase Antibody ELISA kit
GTR10372859 96 Well

Rat Prostatic Acid Phosphatase Antibody ELISA kit

Sign In for Pricing
View Details
Human Cyclophilin F (PPIF) AssayLite™ Antibody (RPE Conjugate)
35151-05151 5x 30 µg

Human Cyclophilin F (PPIF) AssayLite™ Antibody (RPE Conjugate)

Sign In for Pricing
View Details
Rabbit Activating Transcription Factor 6 ELISA Kit
MBS028084 Inquire

Rabbit Activating Transcription Factor 6 ELISA Kit

Sign In for Pricing
View Details