Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shewanella sp. Cobalamin synthase (cobS)

This Recombinant Shewanella sp. Cobalamin synthase (cobS) spans the amino acid sequence from region 1-262.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

A0L0D2

Expression Region

1-262

Origin

Shewanella sp. (strain ANA-3)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSERESWHKEIDLFLVAMGYFTRIPMPKWVEVDADKLNKASRYFGLVGLLVGLLSAIVFW LTQNWLPAGVSVLLSMVTGVLLTGGFHEDGLADTFDGFGGGWTAEDKLRIMKDSRLGSYG ALALMLVLMLKWQLLVELALYDPVVAGSAMIVAHTVSRVVAASLIFTEKYVRDDESSKSK PLAQHQGINELFILIASGVLVLLVLKGIAALSLLLVMIGLRRLIVVIFRRQIGGYTGDTL GAAQQICEIVCYFVLLVVGSIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FGF2 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-2235R-BF555-TR 20 µL

FGF2 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
MTCH1 Polyclonal Antibody, APC Conjugated
bs-7630R-APC 100 µL

MTCH1 Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
Anti-TNFRSF12 (Enavatuzumab)-SMCC-DM1 ADC
ADC-W-1898 1 mg

Anti-TNFRSF12 (Enavatuzumab)-SMCC-DM1 ADC

Sign In for Pricing
View Details
OLA1, Reombinant, Human, aa1-396aa, His-Tag (Obg-like ATPase 1)
350142-01 100 µg

OLA1, Reombinant, Human, aa1-396aa, His-Tag (Obg-like ATPase 1)

Sign In for Pricing
View Details
OLA1, Reombinant, Human, aa1-396aa, His-Tag (Obg-like ATPase 1)
350142-02 500 µg

OLA1, Reombinant, Human, aa1-396aa, His-Tag (Obg-like ATPase 1)

Sign In for Pricing
View Details
ROMO1 Rabbit Polyclonal Antibody (BF594)
orb2457915 100 µL

ROMO1 Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details