Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shewanella sp. Cobalamin synthase (cobS)

This Recombinant Shewanella sp. Cobalamin synthase (cobS) spans the amino acid sequence from region 1-262.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

A0L0D2

Expression Region

1-262

Origin

Shewanella sp. (strain ANA-3)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSERESWHKEIDLFLVAMGYFTRIPMPKWVEVDADKLNKASRYFGLVGLLVGLLSAIVFW LTQNWLPAGVSVLLSMVTGVLLTGGFHEDGLADTFDGFGGGWTAEDKLRIMKDSRLGSYG ALALMLVLMLKWQLLVELALYDPVVAGSAMIVAHTVSRVVAASLIFTEKYVRDDESSKSK PLAQHQGINELFILIASGVLVLLVLKGIAALSLLLVMIGLRRLIVVIFRRQIGGYTGDTL GAAQQICEIVCYFVLLVVGSIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HCNP Double Nickase Plasmid (h)
sc-406872-NIC 20 µg

HCNP Double Nickase Plasmid (h)

Sign In for Pricing
View Details
(2E) -3-Methyl-4- (benzyloxy) -2-butenoic Acid Methyl Ester
160166 10 mg

(2E) -3-Methyl-4- (benzyloxy) -2-butenoic Acid Methyl Ester

Sign In for Pricing
View Details
Olfr799 (NM_146927) Mouse Tagged ORF Clone
MG213613 10 µg

Olfr799 (NM_146927) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
JNJ-7706621
A4115-2 2 mg

JNJ-7706621

Sign In for Pricing
View Details
Mouse Monoclonal NF-H Antibody (NAP4) [Alexa Fluor 350]
NB300-136AF350 0.1 mL

Mouse Monoclonal NF-H Antibody (NAP4) [Alexa Fluor 350]

Sign In for Pricing
View Details
HIF-1 alpha Antibody, Clone ESEE122: RPE
SMC-184D-RPE 100 µg

HIF-1 alpha Antibody, Clone ESEE122: RPE

Sign In for Pricing
View Details