Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shewanella sp. Cobalamin synthase (cobS)

This Recombinant Shewanella sp. Cobalamin synthase (cobS) spans the amino acid sequence from region 1-262.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

A0L0D2

Expression Region

1-262

Origin

Shewanella sp. (strain ANA-3)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSERESWHKEIDLFLVAMGYFTRIPMPKWVEVDADKLNKASRYFGLVGLLVGLLSAIVFW LTQNWLPAGVSVLLSMVTGVLLTGGFHEDGLADTFDGFGGGWTAEDKLRIMKDSRLGSYG ALALMLVLMLKWQLLVELALYDPVVAGSAMIVAHTVSRVVAASLIFTEKYVRDDESSKSK PLAQHQGINELFILIASGVLVLLVLKGIAALSLLLVMIGLRRLIVVIFRRQIGGYTGDTL GAAQQICEIVCYFVLLVVGSIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAB1A Polyclonal Antibody
E55A03366 100 µg

RAB1A Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Pla2g1b Pre-designed siRNA Set A
SI110648A 1 Each

Mouse Pla2g1b Pre-designed siRNA Set A

Sign In for Pricing
View Details
Gnrhr Mouse Gene Knockout Kit (CRISPR)
KN507105 1 Kit

Gnrhr Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
KCNIP2 (Kv Channel-interacting Protein 2, KChIP2, A-type Potassium Channel Modulatory Protein 2, Cardiac Voltage-gated Potassium Channel Modulatory Subunit, Potassium Channel-interacting Protein 2, DKFZp566L1246, MGC17241) (MaxLight 650)
128744-ML650 100 µL

KCNIP2 (Kv Channel-interacting Protein 2, KChIP2, A-type Potassium Channel Modulatory Protein 2, Cardiac Voltage-gated Potassium Channel Modulatory Subunit, Potassium Channel-interacting Protein 2, DKFZp566L1246, MGC17241) (MaxLight 650)

Sign In for Pricing
View Details
RHOJ siRNA (Human)
orb1856833-01 15 nmol

RHOJ siRNA (Human)

Sign In for Pricing
View Details
RHOJ siRNA (Human)
orb1856833-02 30 nmol

RHOJ siRNA (Human)

Sign In for Pricing
View Details