Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shewanella sp. Cobalamin synthase (cobS)

This Recombinant Shewanella sp. Cobalamin synthase (cobS) spans the amino acid sequence from region 1-262.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

A1RGP2

Expression Region

1-262

Origin

Shewanella sp. (strain W3-18-1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSERESWHKEIDLFLVAMGYFTRIPMPKWVEVDSDKLNKASRYFGLVGLLIGLLSAIVFW LTQNWLPAGVSVLLAMLVGVLLTGGFHEDGLADTFDGFGGGWTAEDKLRIMKDSRLGSYG AIALILALLLKWQLLVELALYDPVVAGSALIVAHTVSRVVAASIIFTEKYVRDDETSKSK PLSQHQGINELFILVASGVLVLLFLKGLAALSLLLVMIGLRRLIVVIFRRQIGGYTGDTL GAAQQICEIVCYLVLLIVGSIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3’-Hydroxy Diclofenac
TRC-H825725-25MG 25 mg

3’-Hydroxy Diclofenac

Sign In for Pricing
View Details
Nb-Butylajmalinium Iodide
TRC-B474780-250MG 250 mg

Nb-Butylajmalinium Iodide

Sign In for Pricing
View Details
ETV6 (NM_001987) Human Recombinant Protein
TP308185M 100 µg

ETV6 (NM_001987) Human Recombinant Protein

Sign In for Pricing
View Details
Cytochrome C (Mitochondrial Marker) (rCYCS/1010), CF640R conjugate, 0.1mg/mL
BNC403641-100 1x 100 µL

Cytochrome C (Mitochondrial Marker) (rCYCS/1010), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (BP53-12 + DO-7), CF568 conjugate, 0.1mg/mL
BNC680723-500 1x 500 µL

P53 (BP53-12 + DO-7), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MICA (NM_001177519) Human Over-expression Lysate
LY432900 100 µg

MICA (NM_001177519) Human Over-expression Lysate

Sign In for Pricing
View Details