Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shewanella baltica Cobalamin synthase (cobS)

This Recombinant Shewanella baltica Cobalamin synthase (cobS) spans the amino acid sequence from region 1-262.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

A3D7X7

Expression Region

1-262

Origin

Shewanella baltica (strain OS155 / ATCC BAA-1091)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSERESWHKEIDLFLVAMGYFTRIPMPKWVEADSDKLNKASRYFGLVGLLVGLLSAIVFW LTQNWLPAGVSVLLAMLVGVLLTGGFHEDGLADTFDGFGGGWTAEDKLRIMKDSRLGSYG ALALMLALLLKWQLLVELALYDPVVAGSALIVAHTVSRMVSASIIFSEKYVRDDETSKSK PLSQHQGINELLILIASGVLVLLFLKGLAALSLLLVMIGLRRLIIVIFRRQIGGYTGDTL GAAQQIAEIVCYFVLLVVGNIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPER CRISPR Knock Out 293T Cell Line (Human)
22462141 1x 10^6 Cells / 1.0 mL

GPER CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
SAT2 Antibody
orb842115 2 mg

SAT2 Antibody

Sign In for Pricing
View Details
Recombinant Mouse CD28 Protein, N-His
orb2832064-01 20 µg

Recombinant Mouse CD28 Protein, N-His

Sign In for Pricing
View Details
Recombinant Mouse CD28 Protein, N-His
orb2832064-02 50 µg

Recombinant Mouse CD28 Protein, N-His

Sign In for Pricing
View Details
Recombinant Mouse CD28 Protein, N-His
orb2832064-03 100 µg

Recombinant Mouse CD28 Protein, N-His

Sign In for Pricing
View Details
Chelerythrine chloride
TC026155 20mg

Chelerythrine chloride

Sign In for Pricing
View Details