Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shewanella putrefaciens Cobalamin synthase (cobS)

This Recombinant Shewanella putrefaciens Cobalamin synthase (cobS) spans the amino acid sequence from region 1-262.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

A4Y9P2

Expression Region

1-262

Origin

Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSERESWHKEIDLFLVAMGYFTRIPMPKWVEVDSDKLNKASRYFGLVGLLIGLLSAIVFW LTQNWLPAGVSVLLAMLVGVLLTGGFHEDGLADTFDGFGGGWTAEDKLRIMKDSRLGSYG AIALILALLLKWQLLVELALYDPVVAGSALIVAHTVSRVVAASIIFTEKYVRDDETSKSK PLSQHQGINELFILVASGVLVLLFLKGLAALSLLLVMIGLRRLIVVIFRRQIGGYTGDTL GAAQQICEIVCYLVLLIVGSIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 18 Recombinant Mouse Monoclonal Antibody [6-19-R]
HA601269 100 µL

Cytokeratin 18 Recombinant Mouse Monoclonal Antibody [6-19-R]

Sign In for Pricing
View Details
Human STX17 activation kit by CRISPRa
GA110453 1 Kit

Human STX17 activation kit by CRISPRa

Sign In for Pricing
View Details
1-Propylamine-d3
TRC-P833703-5MG 5 mg

1-Propylamine-d3

Sign In for Pricing
View Details
Weighing Scale BBAL-408
BBAL-408 1 Unit

Weighing Scale BBAL-408

Sign In for Pricing
View Details
Calcineurin B / PPP3R1 (BE2.1), 0.2mg/mL
BNUB2321-500 1x 500 µL

Calcineurin B / PPP3R1 (BE2.1), 0.2mg/mL

Sign In for Pricing
View Details
GLUT-1 Polyclonal Antibody
E-AB-70090-01 60 µL

GLUT-1 Polyclonal Antibody

Sign In for Pricing
View Details