Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shewanella putrefaciens Cobalamin synthase (cobS)

This Recombinant Shewanella putrefaciens Cobalamin synthase (cobS) spans the amino acid sequence from region 1-262.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

A4Y9P2

Expression Region

1-262

Origin

Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSERESWHKEIDLFLVAMGYFTRIPMPKWVEVDSDKLNKASRYFGLVGLLIGLLSAIVFW LTQNWLPAGVSVLLAMLVGVLLTGGFHEDGLADTFDGFGGGWTAEDKLRIMKDSRLGSYG AIALILALLLKWQLLVELALYDPVVAGSALIVAHTVSRVVAASIIFTEKYVRDDETSKSK PLSQHQGINELFILVASGVLVLLFLKGLAALSLLLVMIGLRRLIVVIFRRQIGGYTGDTL GAAQQICEIVCYLVLLIVGSIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CXCL6/GCP-2 Recombinant Rabbit monoclonal Antibody
HA723316B 100 µL

Human CXCL6/GCP-2 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Human PI3/Elafin Protein (His Tag)
PKSH032375-01 10 µg

Recombinant Human PI3/Elafin Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human PI3/Elafin Protein (His Tag)
PKSH032375-02 50 µg

Recombinant Human PI3/Elafin Protein (His Tag)

Sign In for Pricing
View Details
SNX16 (NM_152836) Human Recombinant Protein
TP307476 20 µg

SNX16 (NM_152836) Human Recombinant Protein

Sign In for Pricing
View Details
MED4 Recombinant Rabbit Monoclonal Antibody [JE56-55]
HA720007 100 µL

MED4 Recombinant Rabbit Monoclonal Antibody [JE56-55]

Sign In for Pricing
View Details
Recombinant Human FLT1 Protein (aa 1-328, His Tag)
PKSH031841 100 µg

Recombinant Human FLT1 Protein (aa 1-328, His Tag)

Sign In for Pricing
View Details