Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shewanella putrefaciens Cobalamin synthase (cobS)

This Recombinant Shewanella putrefaciens Cobalamin synthase (cobS) spans the amino acid sequence from region 1-262.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

A4Y9P2

Expression Region

1-262

Origin

Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSERESWHKEIDLFLVAMGYFTRIPMPKWVEVDSDKLNKASRYFGLVGLLIGLLSAIVFW LTQNWLPAGVSVLLAMLVGVLLTGGFHEDGLADTFDGFGGGWTAEDKLRIMKDSRLGSYG AIALILALLLKWQLLVELALYDPVVAGSALIVAHTVSRVVAASIIFTEKYVRDDETSKSK PLSQHQGINELFILVASGVLVLLFLKGLAALSLLLVMIGLRRLIVVIFRRQIGGYTGDTL GAAQQICEIVCYLVLLIVGSIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (323/A3), CF594 conjugate, 0.1mg/mL
BNC940396-100 1x 100 µL

Ep-CAM / CD326 (323/A3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI10F4]
TA802427BM 100 µL

CD5 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI10F4]

Sign In for Pricing
View Details
BAP1 (BRCA1 Associated Protein 1) (BAP1/2431), CF640R conjugate, 0.1mg/mL
BNC402431-100 1x 100 µL

BAP1 (BRCA1 Associated Protein 1) (BAP1/2431), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human DNAI7 activation kit by CRISPRa
GA110652 1 Kit

Human DNAI7 activation kit by CRISPRa

Sign In for Pricing
View Details
5-Hydroxy-2’-deoxycytidine
TRC-H946650-10MG 10 mg

5-Hydroxy-2’-deoxycytidine

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary: left
CS702079 5x 5 µm

Tissue FFPE Sections, Ovary: left

Sign In for Pricing
View Details