Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shewanella baltica Cobalamin synthase (cobS)

This Recombinant Shewanella baltica Cobalamin synthase (cobS) spans the amino acid sequence from region 1-262.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

A6WJZ2

Expression Region

1-262

Origin

Shewanella baltica (strain OS185)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSERESWHKEIDLFLVAMGYFTRIPMPKWVEVDSDKLNKASRYFGLVGLLVGLLSAIVFW LTQNWLPAGVSVLLAMLVGVLLTGGFHEDGLADTFDGFGGGWTAEDKLRIMKDSRLGSYG ALALILALLLKWQLLVELALYDPVVAGSALIVAHTVSRVVSASIIFSEKYVRDDETSKSK PLSQHQGINELLILIASGVLVLLFLKGLAALSLLLVMIGLRRLIIVIFRRQIGGYTGDTL GAAQQIAEIVCYFVLLVVGNIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDCD2 Antibody
KC-22675-01 50 μL

PDCD2 Antibody

Sign In for Pricing
View Details
PDCD2 Antibody
KC-22675-02 100 µL

PDCD2 Antibody

Sign In for Pricing
View Details
PDCD2 Antibody
KC-22675-03 1 mL

PDCD2 Antibody

Sign In for Pricing
View Details
Human PAPOLG activation kit by CRISPRa
GA112188 1 Kit

Human PAPOLG activation kit by CRISPRa

Sign In for Pricing
View Details
L-beta-Imidazole Lactic Acid Monohydrate
TRC-I355000-1G 1 g

L-beta-Imidazole Lactic Acid Monohydrate

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse CD51 Antibody[RMV-7]
E-AB-F1235H-01 50 Tests

PE/Cyanine7 Anti-Mouse CD51 Antibody[RMV-7]

Sign In for Pricing
View Details