Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shewanella baltica Cobalamin synthase (cobS)

This Recombinant Shewanella baltica Cobalamin synthase (cobS) spans the amino acid sequence from region 1-262.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

A9L3D9

Expression Region

1-262

Origin

Shewanella baltica (strain OS195)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSERESWHKEIDLFLVAMGYFTRIPMPKWVEVDSDKLNKASRYFGLVGLLVGLLSAIVFW LTQNWLPAGVSVLLAMLVGVLLTGGFHEDGLADTFDGFGGGWTAEDKLRIMKDSRLGSYG ALALMLALLLKWQLLVELALYDPVVAGSALIVAHTVSRVVSASIIFSEKYVRDDETSKSK PLSQHQGINELLILIASGVLVLLFLKGLAALSLLLVMIGLRRLIIVIFRRQIGGYTGDTL GAAQQIAEIVCYFVLLVVGNIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tryptophanyl tRNA synthetase/WRS Antibody
KC-17120-01 50 μL

Tryptophanyl tRNA synthetase/WRS Antibody

Sign In for Pricing
View Details
Tryptophanyl tRNA synthetase/WRS Antibody
KC-17120-02 100 µL

Tryptophanyl tRNA synthetase/WRS Antibody

Sign In for Pricing
View Details
Tryptophanyl tRNA synthetase/WRS Antibody
KC-17120-03 1 mL

Tryptophanyl tRNA synthetase/WRS Antibody

Sign In for Pricing
View Details
(3S,3aR,6aS)-Hexahydrofuro[2,3-b]furan-3-yl Acetate
TRC-H293980-5MG 5 mg

(3S,3aR,6aS)-Hexahydrofuro[2,3-b]furan-3-yl Acetate

Sign In for Pricing
View Details
Human RUFY4 activation kit by CRISPRa
GA117197 1 Kit

Human RUFY4 activation kit by CRISPRa

Sign In for Pricing
View Details
Glutathione S Transferase theta 2 (GSTT2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI9A1]
TA501881AM 100 µL

Glutathione S Transferase theta 2 (GSTT2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI9A1]

Sign In for Pricing
View Details