Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shewanella baltica Cobalamin synthase (cobS)

This Recombinant Shewanella baltica Cobalamin synthase (cobS) spans the amino acid sequence from region 1-262.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

A9L3D9

Expression Region

1-262

Origin

Shewanella baltica (strain OS195)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSERESWHKEIDLFLVAMGYFTRIPMPKWVEVDSDKLNKASRYFGLVGLLVGLLSAIVFW LTQNWLPAGVSVLLAMLVGVLLTGGFHEDGLADTFDGFGGGWTAEDKLRIMKDSRLGSYG ALALMLALLLKWQLLVELALYDPVVAGSALIVAHTVSRVVSASIIFSEKYVRDDETSKSK PLSQHQGINELLILIASGVLVLLFLKGLAALSLLLVMIGLRRLIIVIFRRQIGGYTGDTL GAAQQIAEIVCYFVLLVVGNIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tmem87a Mouse Gene Knockout Kit (CRISPR)
KN517907 1 Kit

Tmem87a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ornithine Decarboxylase-1 (ODC-1) (rODC1/485), 0.2mg/mL
BNUB3439-500 1x 500 µL

Ornithine Decarboxylase-1 (ODC-1) (rODC1/485), 0.2mg/mL

Sign In for Pricing
View Details
AGR3 Mouse Monoclonal Antibody [Clone ID: AGR3.4]
AM26019PU-N 100 µg

AGR3 Mouse Monoclonal Antibody [Clone ID: AGR3.4]

Sign In for Pricing
View Details
Recombinant Human YY1 Protein (His Tag)
PKSH033137-01 10 µg

Recombinant Human YY1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human YY1 Protein (His Tag)
PKSH033137-02 50 µg

Recombinant Human YY1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant SARS-CoV Nucleoprotein / NP Protein (His Tag)
PKSV030248 100 µg

Recombinant SARS-CoV Nucleoprotein / NP Protein (His Tag)

Sign In for Pricing
View Details