Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dehalococcoides sp. Sec-independent protein translocase protein TatC (tatC)

This Recombinant Dehalococcoides sp. Sec-independent protein translocase protein TatC (tatC) spans the amino acid sequence from region 1-262.

Product Specifications

Product Name Alternative

Sec-independent protein translocase protein TatC

UniProt

D2BJS8

Expression Region

1-262

Origin

Dehalococcoides sp. (strain VS)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSKNETPEVEEEEPPEEAKAKGKMPIGGHFNELRQRFTRGIIALVMGVMVAFFFATPII GFLTAPGGPDFKPAQLGVMEYASVFFNVSLWAGFIIASPYILYQLIAFITPALNRNEKKF IFIAIPAVTVMFLAGLAFAYYVALPPALNILLHWGDDVVLTVVGIKDYMNVVTRILIALG LIFETPFIIMVLARLGVVSPQWLASKRKIWVVIAFVIAALITPTFDPVNQTIMAGPLIVL YEISIWLSKLVYRKKREVSESK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF740 conjugate, 0.1mg/mL
BNC741073-500 1x 500 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF555 conjugate, 0.1mg/mL
BNC550333-500 1x 500 µL

CD8 (RIV11), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF740 conjugate, 0.1mg/mL
BNC741052-100 1x 100 µL

CD3e (B-B12), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF640R conjugate, 0.1mg/mL
BNC400324-100 1x 100 µL

CD53 (161-2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF647 conjugate, 0.1mg/mL
BNC470977-100 1x 100 µL

TGF-beta (1D11.16.8), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF488A conjugate, 0.1mg/mL
BNC880305-100 1x 100 µL

CD95 (B-R18), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details