Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shewanella sp. Cobalamin synthase (cobS)

This Recombinant Shewanella sp. Cobalamin synthase (cobS) spans the amino acid sequence from region 1-262.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q0HRU2

Expression Region

1-262

Origin

Shewanella sp. (strain MR-7)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSERESWHKEIDLFLVAMGYFTRIPMPKWVEVDADKLNKASRYFGLVGLLVGLLSAIVFW LTQNWLPAGVSVLLSMVTGVLLTGGFHEDGLADTFDGFGGGWTAEDKLRIMKDSRLGSYG ALALMLVLMLKWQLLVELALYDPVVAGSAMIVAHTVSRVVAASLIFTEKYVRDDESSKSK PLAQHQGINELFILIASGVLVLLVLKGIAALSLLLVMIGLRRLIVVIFRRQIGGYTGDTL GAAQQICEIVCYFVLLVVGSIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Reichardt’s Dye (Technical Grade)
TRC-R225240-50MG 50 mg

Reichardt’s Dye (Technical Grade)

Sign In for Pricing
View Details
Human SGCZ activation kit by CRISPRa
GA115289 1 Kit

Human SGCZ activation kit by CRISPRa

Sign In for Pricing
View Details
Qrfpr Mouse Gene Knockout Kit (CRISPR)
KN514307 1 Kit

Qrfpr Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant NUP155 Antibody
RC-5838-01 50 μL

Recombinant NUP155 Antibody

Sign In for Pricing
View Details
Recombinant NUP155 Antibody
RC-5838-02 100 µL

Recombinant NUP155 Antibody

Sign In for Pricing
View Details
Recombinant NUP155 Antibody
RC-5838-03 1 mL

Recombinant NUP155 Antibody

Sign In for Pricing
View Details