Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Rhomboid protein 2 (RBD2)

This Recombinant Saccharomyces cerevisiae Rhomboid protein 2 (RBD2) spans the amino acid sequence from region 1-262.

Product Specifications

Product Name Alternative

Rhomboid protein 2, EC= 3.4.21.-

UniProt

Q12270

Expression Region

1-262

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNWKSYVFPGGHPPAALTTGLVVFLTAIYLLSFIFALREDLSLAPESLFKLQMSRLSLYP LIHLSLPHLLFNVLAIWAPLNLFEETHGTVYTGVFLNLSALFAGILYCLLGKLLYPEALV AGASGWCFTLFAYYSFKESQIRPRTRIFRTDYSIPTLYTPLVLLVAIAVVIPGSSFWGHF FGLCVGYAIGYKESWFNKITPPGWIITKIEKSLDGLIRLIPWGIKYYRDEDIDRTKDYEP LMSTETPLPLHNDNSGTVLGTA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF405S conjugate, 0.1mg/mL
BNC041073-500 1x 500 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF405S conjugate, 0.1mg/mL
BNC040391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pmel17 / gp100 / SILV (NKI-beteb), CF405S conjugate, 0.1mg/mL
BNC040226-500 1x 500 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF740 conjugate, 0.1mg/mL
BNC740029-100 1x 100 µL

Fibronectin (TV-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10 + M2-9E3), CF594 conjugate, 0.1mg/mL
BNC940705-500 1x 500 µL

MART-1 / Melan-A (M2-7C10 + M2-9E3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), Biotin conjugate, 0.1mg/mL
BNCB0630-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details