Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Erythrobacter litoralis ATP synthase subunit a (atpB)

This Recombinant Erythrobacter litoralis ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-262.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q2N9P2

Expression Region

1-262

Origin

Erythrobacter litoralis (strain HTCC2594)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAESGKVDPMKQFSIEPMLGSEGWEIAGYNIAFTNSAAWMALTTVLLAVFVWGGMKGQL VPGRWQMMVESFTSFIDDMLEVNIGKAGRKYVPYVFSLFMFILFGNLLGLLPLGVLGIHP FTFTSHFTITGVLAIISFSIVLIVGFWKHGFHFFSLFVPSGTPLPMIPIIFPIELISFLV RPFSLALRLFVAMMAGHVLLKVLSSFVIDGINAGAGFGLLVGAPSFILMIGISALEILVA GIQAYVFALLTSLYINDAENLH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® Violet 610 Anti-Mouse CD11c Antibody[N418]
E-AB-F0991UT-01 25 µg

Elab Fluor® Violet 610 Anti-Mouse CD11c Antibody[N418]

Sign In for Pricing
View Details
Elab Fluor® Violet 610 Anti-Mouse CD11c Antibody[N418]
E-AB-F0991UT-02 100 µg

Elab Fluor® Violet 610 Anti-Mouse CD11c Antibody[N418]

Sign In for Pricing
View Details
Tissue FFPE Sections, Pancreas
CS805145 5x 5 µm

Tissue FFPE Sections, Pancreas

Sign In for Pricing
View Details
DPEP1 (NM_004413) Human Over-expression Lysate
LC401402 20 µg

DPEP1 (NM_004413) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse CXCL9 Recombinant Rabbit monoclonal Antibody
HA725024B 100 µL

Mouse CXCL9 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
BstXI, 200U
RE1240 200 U

BstXI, 200U

Sign In for Pricing
View Details