Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Erythrobacter litoralis ATP synthase subunit a (atpB)

This Recombinant Erythrobacter litoralis ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-262.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q2N9P2

Expression Region

1-262

Origin

Erythrobacter litoralis (strain HTCC2594)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAESGKVDPMKQFSIEPMLGSEGWEIAGYNIAFTNSAAWMALTTVLLAVFVWGGMKGQL VPGRWQMMVESFTSFIDDMLEVNIGKAGRKYVPYVFSLFMFILFGNLLGLLPLGVLGIHP FTFTSHFTITGVLAIISFSIVLIVGFWKHGFHFFSLFVPSGTPLPMIPIIFPIELISFLV RPFSLALRLFVAMMAGHVLLKVLSSFVIDGINAGAGFGLLVGAPSFILMIGISALEILVA GIQAYVFALLTSLYINDAENLH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STAT3 (NM_213662) Human Recombinant Protein
TP312394M 100 µg

STAT3 (NM_213662) Human Recombinant Protein

Sign In for Pricing
View Details
PE Anti-Mouse CD117/c-Kit Antibody[2B8]
E-AB-F1092UD-01 25 µg

PE Anti-Mouse CD117/c-Kit Antibody[2B8]

Sign In for Pricing
View Details
PE Anti-Mouse CD117/c-Kit Antibody[2B8]
E-AB-F1092UD-02 100 µg

PE Anti-Mouse CD117/c-Kit Antibody[2B8]

Sign In for Pricing
View Details
Blood Group Antigen B (CD173) (HEB-20), CF594 conjugate, 0.1mg/mL
BNC940296-100 1x 100 µL

Blood Group Antigen B (CD173) (HEB-20), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
p95 NBS1 (NBN) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2F5]
TA801421BM 100 µL

p95 NBS1 (NBN) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2F5]

Sign In for Pricing
View Details
GAD65 (GAD2) Human Gene Knockout Kit (CRISPR)
KN423464 1 Kit

GAD65 (GAD2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details