Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Emericella nidulans Protein alcS (alcS)

This Recombinant Emericella nidulans Protein alcS (alcS) spans the amino acid sequence from region 1-262.

Product Specifications

Product Name Alternative

Protein alcS

UniProt

Q460G9

Expression Region

1-262

Origin

Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTEISNGEAKGHHLSTIPSSITLSAEQFEKLYLSPMMRQQPSLARKVGNPTPLALGGFV ITTTPLSCCLMAWRGSSGNGIAFIGPIIFLGGLLLLITSILEFILGNTFPCVVFGTIGGF WFAFAATMIPSFNAAAPYSSSATSTTAGLTSASFMNTYAFLFITMAVLMLIFLLCATRTN VVYTLIFLSLLLVFLLLSAGYWRLGEGDAAVGDRCIKGAGASLFVASLLGFYLLIAQLFD AVGLPITLPVGDMERFWPRSQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Munc18 1 (STXBP1) (NM_001032221) Human Over-expression Lysate
LY422289 100 µg

Munc18 1 (STXBP1) (NM_001032221) Human Over-expression Lysate

Sign In for Pricing
View Details
Progesterone (6-5E-3F), Biotin conjugate, 0.1mg/mL
BNCB0236-500 1x 500 µL

Progesterone (6-5E-3F), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Dopamine beta Hydroxylase Antibody
KC-22748-01 50 μL

Dopamine beta Hydroxylase Antibody

Sign In for Pricing
View Details
Dopamine beta Hydroxylase Antibody
KC-22748-02 100 µL

Dopamine beta Hydroxylase Antibody

Sign In for Pricing
View Details
Dopamine beta Hydroxylase Antibody
KC-22748-03 1 mL

Dopamine beta Hydroxylase Antibody

Sign In for Pricing
View Details
Phospho-MCM2 (S41) Recombinant Rabbit Monoclonal Antibody [JE50-04]
HA722279 100 µL

Phospho-MCM2 (S41) Recombinant Rabbit Monoclonal Antibody [JE50-04]

Sign In for Pricing
View Details