Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0096 (MJ0096)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0096 (MJ0096) spans the amino acid sequence from region 1-262.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ0096

UniProt

Q57561

Expression Region

1-262

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEVKAMEIFKKYLSLNIPKKILITYFLCWAGFLFSFSVGKFLLYLSSILKSNFISEPAKL AQSVGTAKFNAVSSAVSNTVGVKNAYLTYALSYIVSNFMGCLIIMFALGALAYLYKKDLE KAKTLEEKEELFKCYQKYLLILFIFTVINPLTGLIGVNLQYSDLIAVLPHGFFEFFGFAT AVVVGVELSNKILPIVKREITSKKIVILIACSFIFIFIAGMLEPIDWFIYSYAKAYGIPL LAAFATGYKNLFLYLISMLFKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat ICOS/AILIM/CD278 Protein (Fc Tag)
PKSR030191 100 µg

Recombinant Rat ICOS/AILIM/CD278 Protein (Fc Tag)

Sign In for Pricing
View Details
Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/2039), CF594 conjugate, 0.1mg/mL
BNC942039-500 1x 500 µL

Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/2039), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Renalase Recombinant Rabbit Monoclonal Antibody [JE38-03]
HA722336 100 µL

Renalase Recombinant Rabbit Monoclonal Antibody [JE38-03]

Sign In for Pricing
View Details
Colloidal Gold Conjugated Rabbit Affinity Purified Antibody to Protein A,  10nm
GAP-01-10 1 mL

Colloidal Gold Conjugated Rabbit Affinity Purified Antibody to Protein A, 10nm

Sign In for Pricing
View Details
2-Amino-3-nitrobenzoic Acid
TRC-A618394-5G 5 g

2-Amino-3-nitrobenzoic Acid

Sign In for Pricing
View Details
Recombinant PRMT5 Antibody
RC-6882-01 50 μL

Recombinant PRMT5 Antibody

Sign In for Pricing
View Details