Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0096 (MJ0096)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0096 (MJ0096) spans the amino acid sequence from region 1-262.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ0096

UniProt

Q57561

Expression Region

1-262

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEVKAMEIFKKYLSLNIPKKILITYFLCWAGFLFSFSVGKFLLYLSSILKSNFISEPAKL AQSVGTAKFNAVSSAVSNTVGVKNAYLTYALSYIVSNFMGCLIIMFALGALAYLYKKDLE KAKTLEEKEELFKCYQKYLLILFIFTVINPLTGLIGVNLQYSDLIAVLPHGFFEFFGFAT AVVVGVELSNKILPIVKREITSKKIVILIACSFIFIFIAGMLEPIDWFIYSYAKAYGIPL LAAFATGYKNLFLYLISMLFKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UXS 1 (UXS1) Human Gene Knockout Kit (CRISPR)
KN203354BN 1 Kit

UXS 1 (UXS1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SLC38A3 (Center) Rabbit Polyclonal Antibody
AP17749PU-N 400 µL

SLC38A3 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Mouse CD335/NKp46 Antibody[29A1.4]
E-AB-F1182G-01 50 Tests

PE/Cyanine5 Anti-Mouse CD335/NKp46 Antibody[29A1.4]

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Mouse CD335/NKp46 Antibody[29A1.4]
E-AB-F1182G-02 100 Tests

PE/Cyanine5 Anti-Mouse CD335/NKp46 Antibody[29A1.4]

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Mouse CD335/NKp46 Antibody[29A1.4]
E-AB-F1182G-03 2x 100 Tests

PE/Cyanine5 Anti-Mouse CD335/NKp46 Antibody[29A1.4]

Sign In for Pricing
View Details
VILIP1 (VSNL1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3B9]
TA802075AM 100 µL

VILIP1 (VSNL1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3B9]

Sign In for Pricing
View Details