Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0096 (MJ0096)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0096 (MJ0096) spans the amino acid sequence from region 1-262.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ0096

UniProt

Q57561

Expression Region

1-262

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEVKAMEIFKKYLSLNIPKKILITYFLCWAGFLFSFSVGKFLLYLSSILKSNFISEPAKL AQSVGTAKFNAVSSAVSNTVGVKNAYLTYALSYIVSNFMGCLIIMFALGALAYLYKKDLE KAKTLEEKEELFKCYQKYLLILFIFTVINPLTGLIGVNLQYSDLIAVLPHGFFEFFGFAT AVVVGVELSNKILPIVKREITSKKIVILIACSFIFIFIAGMLEPIDWFIYSYAKAYGIPL LAAFATGYKNLFLYLISMLFKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTRP6 (C1QTNF6) Rabbit Polyclonal Antibody
AP07289PU-N 50 µg

CTRP6 (C1QTNF6) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
E2F1 Recombinant Rabbit Monoclonal Antibody [JJ092-02]
ET1701-73 100 µL

E2F1 Recombinant Rabbit Monoclonal Antibody [JJ092-02]

Sign In for Pricing
View Details
2-Ethoxybenzoyl Chloride
TRC-E937855-5G 5 g

2-Ethoxybenzoyl Chloride

Sign In for Pricing
View Details
CD45RO (UCHL1 + T200/797), Biotin conjugate, 0.1mg/mL
BNCB1209-100 1x 100 µL

CD45RO (UCHL1 + T200/797), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Hexahydro-1,3-isobenzofurandione
TRC-H294020-2.5G 2.5 g

Hexahydro-1,3-isobenzofurandione

Sign In for Pricing
View Details
EGFR (Epidermal Growth Factor Receptor) (GFR/2341), CF568 conjugate, 0.1mg/mL
BNC682341-100 1x 100 µL

EGFR (Epidermal Growth Factor Receptor) (GFR/2341), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details