Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1307 (MJ1307)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1307 (MJ1307) spans the amino acid sequence from region 1-262.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ1307

UniProt

Q58703

Expression Region

1-262

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNSKRDLAVAISFFVFGASVLYSLAHMQISPGVNEVYLTHYIIPNYVCAVIFDWRAYDTL GECLVLVVAVMVSWIVFGKSLYDNTYLKELFHAPESDDYITLQGWGEYTPIIKFLAFPMS VLMVALGIITVLGGHITPGGGFQGGALIAAAFILSVIAFGSNSPLWFDHKFLEKLEALGA LGYLLLGVAGMFIGGYYLFNFTEINGFTIFPAPKEIITAGIIPYLNIAVGLKVLAGLSTA AFLLSCEKVIIEKISKSEEKLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CRTC3 (CREB Regulated Transcription Coactivator 3) ELISA Kit
ELK3467-01 48 Tests

Human CRTC3 (CREB Regulated Transcription Coactivator 3) ELISA Kit

Sign In for Pricing
View Details
Human CRTC3 (CREB Regulated Transcription Coactivator 3) ELISA Kit
ELK3467-02 96 Tests

Human CRTC3 (CREB Regulated Transcription Coactivator 3) ELISA Kit

Sign In for Pricing
View Details
Human CRTC3 (CREB Regulated Transcription Coactivator 3) ELISA Kit
ELK3467-03 5x 96 Tests

Human CRTC3 (CREB Regulated Transcription Coactivator 3) ELISA Kit

Sign In for Pricing
View Details
Lentiviral human PRKCE shRNA (UAS) - Lentiviral human PRKCE shRNA (UAS, GFP) (100)
GTR15086133 1 Vial

Lentiviral human PRKCE shRNA (UAS) - Lentiviral human PRKCE shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Rabbit anti-human acyl-CoA thioesterase 7 polyclonal Antibody
MBS710202-01 0.1 mL

Rabbit anti-human acyl-CoA thioesterase 7 polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-human acyl-CoA thioesterase 7 polyclonal Antibody
MBS710202-02 5x 0.1 mL

Rabbit anti-human acyl-CoA thioesterase 7 polyclonal Antibody

Sign In for Pricing
View Details