Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca mulatta Nurim (NRM)

This Recombinant Macaca mulatta Nurim (NRM) spans the amino acid sequence from region 1-262.

Product Specifications

Product Name Alternative

Nurim, Nuclear envelope membrane protein, Nuclear rim protein

UniProt

Q5TM67

Expression Region

1-262

Origin

Macaca mulatta (Rhesus macaque)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPALLLVPAALASFILAFGTGVEFVRFTSLRPLLGGIPESGGPDARQGWLAALQDRSIL APLAWDLGLLLLFVGQHSLMAAERVKAWTSRYFGVLQRSLYVACTALALQLVMRYWEPVP RGPVLWEAQAEPWATWVPLLCFVLHVISWLLIFSILLVFDYAELMGLKQVYYHVLGLGEP LALKSPRALRLFSHLRHPVCVELLTVLWVVPTLGMDRLLLALLLTLYLGLAHGLDQQDLR YLRAQLQRKLHLLSRPQDGEAE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MSK1 (RPS6KA5) (NM_182398) Human Over-expression Lysate
LY403633 100 µg

MSK1 (RPS6KA5) (NM_182398) Human Over-expression Lysate

Sign In for Pricing
View Details
Integrin beta 1 (ITGB1) Human Gene Knockout Kit (CRISPR)
KN203818 1 Kit

Integrin beta 1 (ITGB1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cytochrome P450 2A6 Antibody
8C12258-AAT 50 µg

Cytochrome P450 2A6 Antibody

Sign In for Pricing
View Details
Nortilidine Hydrochloride
TRC-N831000-50MG 50 mg

Nortilidine Hydrochloride

Sign In for Pricing
View Details
Tissue Total RNA, Kidney
CR559748 5 µg

Tissue Total RNA, Kidney

Sign In for Pricing
View Details
MTMR12 (NM_001040446) Human Over-expression Lysate
LY421764 100 µg

MTMR12 (NM_001040446) Human Over-expression Lysate

Sign In for Pricing
View Details