Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca mulatta Nurim (NRM)

This Recombinant Macaca mulatta Nurim (NRM) spans the amino acid sequence from region 1-262.

Product Specifications

Product Name Alternative

Nurim, Nuclear envelope membrane protein, Nuclear rim protein

UniProt

Q5TM67

Expression Region

1-262

Origin

Macaca mulatta (Rhesus macaque)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPALLLVPAALASFILAFGTGVEFVRFTSLRPLLGGIPESGGPDARQGWLAALQDRSIL APLAWDLGLLLLFVGQHSLMAAERVKAWTSRYFGVLQRSLYVACTALALQLVMRYWEPVP RGPVLWEAQAEPWATWVPLLCFVLHVISWLLIFSILLVFDYAELMGLKQVYYHVLGLGEP LALKSPRALRLFSHLRHPVCVELLTVLWVVPTLGMDRLLLALLLTLYLGLAHGLDQQDLR YLRAQLQRKLHLLSRPQDGEAE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ras Recombinant Rabbit Monoclonal Antibody [JE44-13]
HA721883 100 µL

Ras Recombinant Rabbit Monoclonal Antibody [JE44-13]

Sign In for Pricing
View Details
Slc39a13 Mouse Gene Knockout Kit (CRISPR)
KN516104 1 Kit

Slc39a13 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
3-Chloropyridine N-Oxide
TRC-C380625-500MG 500 mg

3-Chloropyridine N-Oxide

Sign In for Pricing
View Details
CF®498 Donkey Anti-Guinea Pig IgG (H+L), Highly Cross-Adsorbed, single label for STORM, 1 mg/mL
#20993-500uL 1x 500 µL

CF®498 Donkey Anti-Guinea Pig IgG (H+L), Highly Cross-Adsorbed, single label for STORM, 1 mg/mL

Sign In for Pricing
View Details
Chromogranin A / CHGA (Neuroendocrine Marker) (rCHGA/777), Biotin conjugate, 0.1mg/mL
BNCB1863-100 1x 100 µL

Chromogranin A / CHGA (Neuroendocrine Marker) (rCHGA/777), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
tert-Butyl 3-Hydroxyspiro[indan-1,4'-piperidine]-1'-carboxylate
TRC-T280460-1G 1 g

tert-Butyl 3-Hydroxyspiro[indan-1,4'-piperidine]-1'-carboxylate

Sign In for Pricing
View Details