Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca mulatta Nurim (NRM)

This Recombinant Macaca mulatta Nurim (NRM) spans the amino acid sequence from region 1-262.

Product Specifications

Product Name Alternative

Nurim, Nuclear envelope membrane protein, Nuclear rim protein

UniProt

Q5TM67

Expression Region

1-262

Origin

Macaca mulatta (Rhesus macaque)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPALLLVPAALASFILAFGTGVEFVRFTSLRPLLGGIPESGGPDARQGWLAALQDRSIL APLAWDLGLLLLFVGQHSLMAAERVKAWTSRYFGVLQRSLYVACTALALQLVMRYWEPVP RGPVLWEAQAEPWATWVPLLCFVLHVISWLLIFSILLVFDYAELMGLKQVYYHVLGLGEP LALKSPRALRLFSHLRHPVCVELLTVLWVVPTLGMDRLLLALLLTLYLGLAHGLDQQDLR YLRAQLQRKLHLLSRPQDGEAE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HGS Rabbit Polyclonal Antibody
AP20509PU-N 100 µg

HGS Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RTL1 (NM_001134888) Human Over-expression Lysate
LY427511 100 µg

RTL1 (NM_001134888) Human Over-expression Lysate

Sign In for Pricing
View Details
DEGS2 (NM_206918) Human Over-expression Lysate
LC404167 20 µg

DEGS2 (NM_206918) Human Over-expression Lysate

Sign In for Pricing
View Details
Spermidine or Spermine N1-Acetyltransferase 1 (CPTC-SAT1-3), CF640R conjugate, 0.1mg/mL
BNC402273-500 1x 500 µL

Spermidine or Spermine N1-Acetyltransferase 1 (CPTC-SAT1-3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HDAC11 Human Gene Knockout Kit (CRISPR)
KN401919 1 Kit

HDAC11 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human TMEM229A activation kit by CRISPRa
GA119042 1 Kit

Human TMEM229A activation kit by CRISPRa

Sign In for Pricing
View Details