Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanococcus maripaludis Tetrahydromethanopterin S-methyltransferase subunit C (mtrC)

This Recombinant Methanococcus maripaludis Tetrahydromethanopterin S-methyltransferase subunit C (mtrC) spans the amino acid sequence from region 1-262.

Product Specifications

Product Name Alternative

Tetrahydromethanopterin S-methyltransferase subunit C, EC= 2.1.1.86, N5-methyltetrahydromethanopterin--coenzyme M methyltransferase subunit C

UniProt

Q6LWZ2

Expression Region

1-262

Origin

Methanococcus maripaludis (strain S2 / LL)

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSHGGGGHAAELFPEDQVLAIGAVLSIIGMYVAQFVPSLAMLIGGLLAAGACVAGANTTR RVAAYGLGTGVPSIGMVSLGMGTISALAGVLIPSAFGLPVLATPILAAVIAVVVGFIVGK LTQNPVGMKVPIIVSSMTKLSLMGALAILGFCTAFAGGFSADLIINGAINNGVIALAFIA AGMSILHPFNACIGPDESHKRTITLAVACGLMAWLIFSIAKLDIVSIVVAAIFWLYTYGS FVKMSLGDACEVKYVPELPKKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FRRS1 siRNA (Human)
orb1850247-01 15 nmol

FRRS1 siRNA (Human)

Sign In for Pricing
View Details
FRRS1 siRNA (Human)
orb1850247-02 30 nmol

FRRS1 siRNA (Human)

Sign In for Pricing
View Details
Mouse Vmn1r260 (NM_001166756) AAV Particle
MR221517A1V 250 µL

Mouse Vmn1r260 (NM_001166756) AAV Particle

Sign In for Pricing
View Details
Duck Free Prostate Specific Antigen ELISA Kit
MBS047932 Inquire

Duck Free Prostate Specific Antigen ELISA Kit

Sign In for Pricing
View Details
PSMA1 Antibody
MBS2517031-01 0.06 mL

PSMA1 Antibody

Sign In for Pricing
View Details
PSMA1 Antibody
MBS2517031-02 0.12 mL

PSMA1 Antibody

Sign In for Pricing
View Details