Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Nurim (Nrm)

This Recombinant Rat Nurim (Nrm) spans the amino acid sequence from region 1-262.

Product Specifications

Product Name Alternative

Nurim, Nuclear envelope membrane protein, Nuclear rim protein

UniProt

Q6MG14

Expression Region

1-262

Origin

Rattus norvegicus (Rat)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPALLLVPAALASFVLAFGTGVEFVRFTSLRPLLGGIPESGGPDARHGWLAALQDRSIL ASLAWDLCLLLLFVVQHSLMATEAVKAWTSRYFGVLQRSLYVACTALALQLVMRYWEATP RGPVLWEARAEPWATWVPLLCFVLHVVSWLLIFSILLVFDYAELMGLKQVYYHVLGLGEP LSLKSPRALRLFSHLRHPVCVELLTVLWVVPTLGTDRLLLALLFTLYLGLAHGLDQQDLR YLRSQLQRKLQLLSRPQDGEAE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Standard (HCAM/1097), CF488A conjugate, 0.1mg/mL
BNC881097-100 1x 100 µL

CD44 Standard (HCAM/1097), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Loxapine N-Glucuronide
TRC-L473860-10MG 10 mg

Loxapine N-Glucuronide

Sign In for Pricing
View Details
HERPUD1 (NM_014685) Human Over-expression Lysate
LC402364 20 µg

HERPUD1 (NM_014685) Human Over-expression Lysate

Sign In for Pricing
View Details
TRIB1 (NM_025195) Human Recombinant Protein
TP309219 20 µg

TRIB1 (NM_025195) Human Recombinant Protein

Sign In for Pricing
View Details
UBXD3 (UBXN10) Rabbit Polyclonal Antibody
TA372067 100 µL

UBXD3 (UBXN10) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ethyl 7-Chloro-1-ethyl-6-fluoro-1,4-dihydro-4-oxo-1,8-naphthyridine-3-carboxylate
TRC-E792860-25MG 25 mg

Ethyl 7-Chloro-1-ethyl-6-fluoro-1,4-dihydro-4-oxo-1,8-naphthyridine-3-carboxylate

Sign In for Pricing
View Details