Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Nurim (Nrm)

This Recombinant Rat Nurim (Nrm) spans the amino acid sequence from region 1-262.

Product Specifications

Product Name Alternative

Nurim, Nuclear envelope membrane protein, Nuclear rim protein

UniProt

Q6MG14

Expression Region

1-262

Origin

Rattus norvegicus (Rat)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPALLLVPAALASFVLAFGTGVEFVRFTSLRPLLGGIPESGGPDARHGWLAALQDRSIL ASLAWDLCLLLLFVVQHSLMATEAVKAWTSRYFGVLQRSLYVACTALALQLVMRYWEATP RGPVLWEARAEPWATWVPLLCFVLHVVSWLLIFSILLVFDYAELMGLKQVYYHVLGLGEP LSLKSPRALRLFSHLRHPVCVELLTVLWVVPTLGTDRLLLALLFTLYLGLAHGLDQQDLR YLRSQLQRKLQLLSRPQDGEAE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Adcy3 Mouse Gene Knockout Kit (CRISPR)
KN500889 1 Kit

Adcy3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
BMPR2 (NM_001204) Human Recombinant Protein
TP308673M 100 µg

BMPR2 (NM_001204) Human Recombinant Protein

Sign In for Pricing
View Details
(R)-2-Cyclohexyl-2-hydroxyphenylacetic Acid
TRC-C987923-500MG 500 mg

(R)-2-Cyclohexyl-2-hydroxyphenylacetic Acid

Sign In for Pricing
View Details
Recombinant Rat MCP-1 Protein (Sumo Tag)
PDER100114-01 20 µg

Recombinant Rat MCP-1 Protein (Sumo Tag)

Sign In for Pricing
View Details
Recombinant Rat MCP-1 Protein (Sumo Tag)
PDER100114-02 100 µg

Recombinant Rat MCP-1 Protein (Sumo Tag)

Sign In for Pricing
View Details
Recombinant Rat MCP-1 Protein (Sumo Tag)
PDER100114-03 500 µg

Recombinant Rat MCP-1 Protein (Sumo Tag)

Sign In for Pricing
View Details