Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Nurim (NRM)

This Recombinant Pig Nurim (NRM) spans the amino acid sequence from region 1-262.

Product Specifications

Product Name Alternative

Nurim, Nuclear envelope membrane protein, Nuclear rim protein

UniProt

Q767L9

Expression Region

1-262

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPALLLVPAALASFILAFGTGVEFVRFTSLRPLLGGIPESGGPDARQGWLAALQDQSIL VPLAWDLGLLLLFVGQHSLMATETVKAWMSRYFGVLQRSLYVACTALALQLVMRYWEPVP RGPVLWEAQAEPWATWVPLLCFVLHVISWLLIFSILLVFDYAELMGLKQVYYHVLGLGEP LALKSPRALRLFSHLRHPVCVELLTVLWVVPTLGTDRLLLALLLTLYLGLAHGLDQQDLR YLRAQLQRKLHLLSRPQDGEAE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SRT 1460 100mg
A19026-100 100 mg

SRT 1460 100mg

Sign In for Pricing
View Details
CGP 57380
C12673-10mg 10 mg

CGP 57380

Sign In for Pricing
View Details
ENTPD5 AAV Vector (Mouse) (CMV)
19325105 1 µg

ENTPD5 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
RRNAD1 Protein Vector (Human) (pPM-C-HA)
PV127376 500 ng

RRNAD1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Human ADAMTS13 Affinity Purified Polyclonal Ab
AF4245-SP 25 µg

Human ADAMTS13 Affinity Purified Polyclonal Ab

Sign In for Pricing
View Details
Anti-E3 SUMO-protein ligase PIAS4 Antibody Picoband® Fluoro488 Conjugated
PB10082-Fluoro488 100 µg/Vial

Anti-E3 SUMO-protein ligase PIAS4 Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details