Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Nurim (NRM)

This Recombinant Pig Nurim (NRM) spans the amino acid sequence from region 1-262.

Product Specifications

Product Name Alternative

Nurim, Nuclear envelope membrane protein, Nuclear rim protein

UniProt

Q767L9

Expression Region

1-262

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPALLLVPAALASFILAFGTGVEFVRFTSLRPLLGGIPESGGPDARQGWLAALQDQSIL VPLAWDLGLLLLFVGQHSLMATETVKAWMSRYFGVLQRSLYVACTALALQLVMRYWEPVP RGPVLWEAQAEPWATWVPLLCFVLHVISWLLIFSILLVFDYAELMGLKQVYYHVLGLGEP LALKSPRALRLFSHLRHPVCVELLTVLWVVPTLGTDRLLLALLLTLYLGLAHGLDQQDLR YLRAQLQRKLHLLSRPQDGEAE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human ARAF sgRNA gene knockout kit - Lentiviral human ARAF sgRNA gene knockout kit (100)
GTR15381298 1 Vial

Lentiviral human ARAF sgRNA gene knockout kit - Lentiviral human ARAF sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Human POTEG (POTE Ankyrin Domain Family, Member G) Microsample ELISA Kit
orb2997834-01 48 Tests

Human POTEG (POTE Ankyrin Domain Family, Member G) Microsample ELISA Kit

Sign In for Pricing
View Details
Human POTEG (POTE Ankyrin Domain Family, Member G) Microsample ELISA Kit
orb2997834-02 96 Tests

Human POTEG (POTE Ankyrin Domain Family, Member G) Microsample ELISA Kit

Sign In for Pricing
View Details
ELISA Kit For Receptor tyrosine-protein kinase erbB-3
E9313h 96 Tests

ELISA Kit For Receptor tyrosine-protein kinase erbB-3

Sign In for Pricing
View Details
Recombinant Mouse Uncharacterized protein C9orf172 homolog (Gm996) , partial
MBS1141991 Inquire

Recombinant Mouse Uncharacterized protein C9orf172 homolog (Gm996) , partial

Sign In for Pricing
View Details
Diethyleneglycol Monolauryl Ether
TRC-D444385-500MG 500 mg

Diethyleneglycol Monolauryl Ether

Sign In for Pricing
View Details