Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Nurim (NRM)

This Recombinant Human Nurim (NRM) spans the amino acid sequence from region 1-262.

Product Specifications

Product Name Alternative

Nurim, Nuclear envelope membrane protein, Nuclear rim protein

UniProt

Q8IXM6

Expression Region

1-262

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPALLLIPAALASFILAFGTGVEFVRFTSLRPLLGGIPESGGPDARQGWLAALQDRSIL APLAWDLGLLLLFVGQHSLMAAERVKAWTSRYFGVLQRSLYVACTALALQLVMRYWEPIP KGPVLWEARAEPWATWVPLLCFVLHVISWLLIFSILLVFDYAELMGLKQVYYHVLGLGEP LALKSPRALRLFSHLRHPVCVELLTVLWVVPTLGTDRLLLAFLLTLYLGLAHGLDQQDLR YLRAQLQRKLHLLSRPQDGEAE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NIN Protein Lysate
MBS8416032-01 0.02 mg

Human NIN Protein Lysate

Sign In for Pricing
View Details
Human NIN Protein Lysate
MBS8416032-02 5x 0.02 mg

Human NIN Protein Lysate

Sign In for Pricing
View Details
Anti-GSTA1/GSTA2/GSTA3/GSTA4/GSTA5 Antibody Picoband® (PE Conjugate)
PB9627-PE 100 µg/Vial

Anti-GSTA1/GSTA2/GSTA3/GSTA4/GSTA5 Antibody Picoband® (PE Conjugate)

Sign In for Pricing
View Details
Human Monoclonal CD40/TNFRSF5 Antibody (ravagalimab) [Janelia Fluor 585]
NBP3-28685JF585 0.1 mL

Human Monoclonal CD40/TNFRSF5 Antibody (ravagalimab) [Janelia Fluor 585]

Sign In for Pricing
View Details
Mouse Glce/D-glucuronyl C5-epimerase ELISA Kit
MBS2906788-01 48 Well

Mouse Glce/D-glucuronyl C5-epimerase ELISA Kit

Sign In for Pricing
View Details
Mouse Glce/D-glucuronyl C5-epimerase ELISA Kit
MBS2906788-02 96 Well

Mouse Glce/D-glucuronyl C5-epimerase ELISA Kit

Sign In for Pricing
View Details