Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Nurim (NRM)

This Recombinant Human Nurim (NRM) spans the amino acid sequence from region 1-262.

Product Specifications

Product Name Alternative

Nurim, Nuclear envelope membrane protein, Nuclear rim protein

UniProt

Q8IXM6

Expression Region

1-262

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPALLLIPAALASFILAFGTGVEFVRFTSLRPLLGGIPESGGPDARQGWLAALQDRSIL APLAWDLGLLLLFVGQHSLMAAERVKAWTSRYFGVLQRSLYVACTALALQLVMRYWEPIP KGPVLWEARAEPWATWVPLLCFVLHVISWLLIFSILLVFDYAELMGLKQVYYHVLGLGEP LALKSPRALRLFSHLRHPVCVELLTVLWVVPTLGTDRLLLAFLLTLYLGLAHGLDQQDLR YLRAQLQRKLHLLSRPQDGEAE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SDHA Recombinant Protein
OPCD06876-10UG 10 µg

SDHA Recombinant Protein

Sign In for Pricing
View Details
Human TRAF3IP3 (NM_025228) AAV Particle
RC219475A1V 250 µL

Human TRAF3IP3 (NM_025228) AAV Particle

Sign In for Pricing
View Details
Blotto in TBS Powder
20960013-1 100 g

Blotto in TBS Powder

Sign In for Pricing
View Details
Mouse Pikfyve Pre-designed siRNA Set A
SI110576A 1 Each

Mouse Pikfyve Pre-designed siRNA Set A

Sign In for Pricing
View Details
Lipid HTO12
HY-159714 1 mg (76.44 mM x 20 μL in Ethanol)

Lipid HTO12

Sign In for Pricing
View Details
F (ab') 2 Rat IgG (H&L) Antibody Pre-Adsorbed
orb348363 500 µg

F (ab') 2 Rat IgG (H&L) Antibody Pre-Adsorbed

Sign In for Pricing
View Details